Home > Product > Antimicrobial Peptides > B-defensin2-like protein 1

Antimicrobial Peptides

B-defensin2-like protein 1

[Price Inquiry]
CAT#
AF2525
Sequence
NPVTCLRSGAICHPGFCPRRYKHIGICGVSAIKCCK
Host Chemicals
Macaca mulatta
Length
36
Activity
Antimicrobial
SwissProt ID
B0LFF3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.