Home > Product > Antimicrobial Peptides > Bacteriocin 31

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Bacteriocin 31

[Price Inquiry]
CAT#
AF2983
Sequence
ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGWVQHGPWAPR
Host Chemicals
Enterococcus faecalis YI717
Length
43
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.