Home > Product > Antimicrobial Peptides > Bacteriocin mesentericin Y105

Antimicrobial Peptides

Bacteriocin mesentericin Y105

[Price Inquiry]
CAT#
AF2649
Sequence
KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW
Host Chemicals
Leuconostoc mesenteroides
Length
37
Activity
Antibacterial
SwissProt ID
P38577
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.