CAT# | R1010 |
CAS | 463930-25-8 |
M.F/Formula | C167H270N52O46 |
M.W/Mr. | 3742.29 |
Sequence | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY(Modifications: Tyr-31 = C-terminal amide) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...