Home > Product > Antimicrobial Peptides > Beta-defensin 13 . BNDB-13

Antimicrobial Peptides

Beta-defensin 13 . BNDB-13

[Price Inquiry]
CAT#
AF2963
Sequence
SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
Host Chemicals
Bos taurus
Length
42
Activity
Antibacterial
SwissProt ID
P46171
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.