Home > Product > Antimicrobial Peptides > Beta-defensin 7

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin 7

[Price Inquiry]
CAT#
AF2515
Sequence
NFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR
Host Chemicals
Bos taurus
Length
36
Activity
Antibacterial
SwissProt ID
P46165
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.