Home > Product > Antimicrobial Peptides > Beta defensin 1

Antimicrobial Peptides

Beta defensin 1

[Price Inquiry]
CAT#
AF2534
Sequence
QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR
Host Chemicals
Chinchilla lanigera
Length
36
Activity
Antibacterial, Antifungal
SwissProt ID
P83943
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.