Home > Product > Antimicrobial Peptides > Beta-defensin103A

Antimicrobial Peptides

Beta-defensin103A

[Price Inquiry]
CAT#
AF3146
Sequence
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Host Chemicals
Pongo pygmaeus
Length
45
Activity
Antibacterial
SwissProt ID
A4H200
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.