Home > Product > Antimicrobial Peptides > Big defensin 2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Big defensin 2

[Price Inquiry]
CAT#
AF2952
Sequence
QAQALLPIASYAGLAVSPPVFAALVTAYGVYALYRYNIRREN
Host Chemicals
Crassostrea gigas
Length
42
Activity
Antimicrobial
SwissProt ID
F6M2I2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.