Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Online Inquiry
| CAT# | E09046 |
| CAS | 133551-97-0 net |
| M.F/Formula | C₂₂₃H₃₂₂N₅₆O₆₃S₄ |
| M.W/Mr. | 4923.61 |
| Sequence | One Letter Code: CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH₂
three Letter Code: H-Cys-Thr-Cys-Phe-Thr-Tyr-Lys-Asp-Lys-Glu-Cys-Val-Tyr-Tyr-Cys-His-Leu-Asp-Ile-Ile-Trp-Ile-Asn-Thr-Pro-Glu-Gln-Thr-Val-Pro-Tyr-Gly-Leu-Ser-Asn-Tyr-Arg-Gly-Ser-Phe-Arg-NH₂ trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Required fields are marked with *
×
Ask a Question for Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
