Home > Product > Antimicrobial Peptides > Brazzein

Antimicrobial Peptides

CAT#
AF3307
Sequence
QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Host Chemicals
pulp, fruits, Pentadiplandra brazzeana Baillon
Length
54
Activity
Gram+ & Gram-, Fungi,
SwissProt ID
PDB ID: 1BRZ
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.