Home > Product > Catalog Peptides > Others > C34, gp41 HIV Fragment

Others

C34, gp41 HIV Fragment

[Price Inquiry]
CAT#
H09874
Sequence
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
M.W/Mr.
4248.6
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.