Home > Product > Catalog Peptides > Others > C34, gp41 HIV Fragment

Others

C34, gp41 HIV Fragment

Price Inquiry
CAT#
H09874
Sequence
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
M.W/Mr.
4248.6
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.