Home > Product > Antimicrobial Peptides > Cecropin-A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cecropin-A

[Price Inquiry]
CAT#
AF2466
Sequence
RWKVFKKIEKVGRNIRDGVIKAAPAIEVLGQAKAL
Host Chemicals
Heliothis virescens
Length
35
Activity
Antibacterial, Antifungal
SwissProt ID
P83413
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.