Home > Product > Antimicrobial Peptides > Cecropin-A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cecropin-A

[Price Inquiry]
CAT#
AF2538
Sequence
RWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASIT
Host Chemicals
Trichoplusia ni
Length
36
Activity
Antibacterial
SwissProt ID
P50724
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.