Home > Product > Catalog Peptides > Others > Cecropin B, Free Acid

Others

warning All products are for research use only. Not for human use.

Cecropin B, Free Acid

[Price Inquiry]
CAT#
C13006
Sequence
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
M.W/Mr.
3835.7
Molecular Formula
C176H301N51O42S1
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.