Home > Product > Catalog Peptides > Others > Cecropin B, Free Acid

Others

Cecropin B, Free Acid

Price Inquiry
CAT#
C13006
Sequence
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
M.W/Mr.
3835.7
Molecular Formula
C176H301N51O42S1
Length
35

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.