Home > Product > Antimicrobial Peptides > Cecropin-B1

Antimicrobial Peptides

Cecropin-B1

[Price Inquiry]
CAT#
AF2361
Sequence
GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQAL
Host Chemicals
Culex pipiens pipiens
Length
34
Activity
Antibacterial
SwissProt ID
Q86PR5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.