CEF19, Epstein-Barr Virus latent NA-3A 458-466

CEF19, Epstein-Barr Virus latent NA-3A (458-466) is a single peptide epitope, YPLHEQHGM, representing residues 458-466 of the type 1 Epstein-Barr Virus (EBV) nuclear antigen 3A protein (B95.8 strain). CEF19, Epstein-Barr Virus latent NA-3A (458-466) can significantly affect cytotoxic T-lymphocyte (CTL) recognition.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1277
CAS	157876-41-0
M.F/Formula	C₄₉H₇₀N₁₄O₁₄S
M.W/Mr.	1111.23
Sequence	One Letter Code: YPLHEQHGM three Letter Code: Tyr-Pro-Leu-His-Glu-Gln-His-Gly-Met

CAT#	Product Name	Inquiry
R1365	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
PI-017	BIBO 3304 trifluoroacetate	Inquiry
R1177	Alexamorelin Met 1	Inquiry
R1907	N-p-Tosyl-Gly-Pro-Lys p-nitroanilide acetate salt	Inquiry
R1913	Boc-Phe-Leu-Phe-Leu-Phe	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.