Home > Product > Antimicrobial Peptides > Centrocin 2

Antimicrobial Peptides

Centrocin 2

[Price Inquiry]
CAT#
AF1976
Sequence
SWFSRTVHNVGNAVRKGIHAGQGVCSGLGL
Host Chemicals
Strongylocentrotus droebachiensis
Length
30
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.