Home > Product > Antimicrobial Peptides > ChaC2

Antimicrobial Peptides

CAT#
AF2099
Sequence
GIPCAESCVWIPPCTITALMGCSCKNNVCYNN
Host Chemicals
Chassalia chartacea (or Chassalia curviflora)
Length
32
Activity
Cancer cells
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.