Home > Product > Catalog Peptides > Various Products / Cancer Research > Chlorotoxin (free acid)

Various Products / Cancer Research

Chlorotoxin (free acid)

Price Inquiry
CAT#
C20002
Sequence
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR
M.W/Mr.
3996.76
Molecular Formula
C158H248N52O48S11
Length
36

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.