Home > Product > Catalog Peptides > Others > Chlorotoxin (free acid)

Others

Chlorotoxin (free acid)

[Price Inquiry]
CAT#
C20002
Sequence
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR
M.W/Mr.
3996.76
Molecular Formula
C158H248N52O48S11
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.