Home > Product > Catalog Peptides > Others > Chlorotoxin

Others

warning All products are for research use only. Not for human use.

Chlorotoxin

[Price Inquiry]
CAT#
C20001
Sequence
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2
M.W/Mr.
3995.77
Molecular Formula
C158H249N53O47S11
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.