Home > Product > Antimicrobial Peptides > Class II sec-dependent bacteriocin

Antimicrobial Peptides

Class II sec-dependent bacteriocin

[Price Inquiry]
CAT#
AF2334
Sequence
YYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWV
Host Chemicals
Enterococcus hirae
Length
33
Activity
Antimicrobial
SwissProt ID
Q0Z8B6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.