Home > Product > Antimicrobial Peptides > Coagulin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3098
Sequence
KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGTHKC
Host Chemicals
Bacillus coagulans I-4
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.