Home > Product > Catalog Peptides > Others > Copeptin (rat)

Others

Copeptin (rat)

[Price Inquiry]
CAT#
C28002
Sequence
AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
M.W/Mr.
4281.80
Molecular Formula
C183H307N57O61
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.