CAT# | C0032 |
CAS | 86280-64-0 |
M.F/Formula | C₁₈₃H₃₀₇N₅₇O₆₁ |
M.W/Mr. | 4281.8 |
Sequence | One Letter Code: AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY three Letter Code: H-Ala-Arg-Pro-Ala-Lys-OH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...