Home > Product > Antimicrobial Peptides > Defensin C

Antimicrobial Peptides

Defensin C

[Price Inquiry]
CAT#
AF2303
Sequence
SKWFTPNHAGCAAHCIFLGNRGGRCVGTVCHCR
Host Chemicals
Rhodnius prolixus
Length
33
Activity
Antimicrobial
SwissProt ID
Q86MY1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.