Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2302
Sequence
SKWFTPNHAACAAHCILLGNRGGHCVGTVCHCR
Host Chemicals
Triatoma infestans
Length
33
Activity
Antimicrobial
SwissProt ID
A2T188
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.