Home > Product > Antimicrobial Peptides > Defensin

Antimicrobial Peptides

CAT#
AF2704
Sequence
GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR
Host Chemicals
Aeshna cyanea
Length
38
Activity
Antibacterial
SwissProt ID
P80154
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.