Home > Product > Catalog Peptides > Others > Defensin-like protein 13

Others

warning All products are for research use only. Not for human use.

Defensin-like protein 13

[Price Inquiry]
CAT#
D06011
Sequence
QKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Modifications
Disulfide bonds(4);Pyr(1)
Length
51
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.