Home > Product > Catalog Peptides > Others > Delta-hexatoxin-Ar1a

Others

Delta-hexatoxin-Ar1a

[Price Inquiry]
CAT#
H18005
Sequence
CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQTTITGLFKKC
Modifications
Disulfide bond(4)
Length
21
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.