Home > Product > Catalog Peptides > Others > Delta-hexatoxin-Hv1a

Others

Delta-hexatoxin-Hv1a

Price Inquiry
CAT#
A38001
Sequence
CAKKRNWCGKTEDCCCPMKCVYAWYNEQGSCQSTISALWKKC
Modifications
Disulfide bond(4)
Length
42

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.