Home > Product > Antimicrobial Peptides > Dermaseptin AA-3-6

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Dermaseptin AA-3-6

[Price Inquiry]
CAT#
AF2106
Sequence
GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
Host Chemicals
Agalychnis annae
Length
32
Activity
Antibacterial
SwissProt ID
O93226
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.