Home > Product > Antimicrobial Peptides > Dermaseptin DS VIII-like peptide

Antimicrobial Peptides

Dermaseptin DS VIII-like peptide

[Price Inquiry]
CAT#
AF2176
Sequence
ALWKTMLKKLGTVALHAGKAALGAAADTISQGA
Host Chemicals
Phyllomedusa burmeisteri
Length
33
Activity
Antibacterial, Antifungal, Antiprotozoal
SwissProt ID
P86280
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.