Home > Product > Antimicrobial Peptides > Divercin V41

Antimicrobial Peptides

Divercin V41

[Price Inquiry]
CAT#
AF3036
Sequence
TKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC
Host Chemicals
Carnobacterium divergens
Length
43
Activity
Antibacterial
SwissProt ID
Q9Z4J1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.