Home > Product > Antimicrobial Peptides > Divercin V41

Antimicrobial Peptides

Divercin V41

Price Inquiry
CAT#
AF3036
Sequence
TKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC
Host Chemicals
Carnobacterium divergens
Length
43
Activity
Antibacterial
SwissProt ID
Q9Z4J1

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.