β-Endorphin rat
β-Endorphin is an endogenous opioid peptide that acts as an agonist at μ-opioid receptors (μORs) and exhibits immunomodulatory, neuromodulatory, antidepressant, and antinociceptive/analgesic activities. In vivo, β-endorphin increases levels of B-cells and production of antibodies as well as secretion of IL-4 and proliferation of splenocytes, shifting the immune response toward Th2-specific mediators.
Online Inquiry
| CAT# | R1885 |
| CAS | 77367-63-6 |
| Synonyms/Alias | β-Lipotropin (61-91), rat; Proopiomelanocortin; POMC. |
| M.F/Formula | C157H254N42O44S |
| M.W/Mr. | 3466.02 |
| Sequence | One Letter Code: YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
Three Letter Code: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln |
| Appearance | Whithe powder |
| Purity | ≥97% (HPLC) |
| Storage | Store at -20°C |
Solubility | Soluble in water. |
Shipping Condition | RT, or blue ice upon request. |
Write a review
Ask a question
My Review for β-Endorphin rat
Required fields are marked with *
×
Ask a Question for β-Endorphin rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
