Home > Product > Catalog Peptides > Others > Erabutoxin a

Others

warning All products are for research use only. Not for human use.

Erabutoxin a

[Price Inquiry]
CAT#
N10003
Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Modifications
Disulfide bond(4)
Length
62
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.