Home > Product > Antimicrobial Peptides > Esculentin-1ARb

Antimicrobial Peptides

Esculentin-1ARb

[Price Inquiry]
CAT#
AF3190
Sequence
GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC
Host Chemicals
the crawfish frog, Rana areolata, North America
Length
46
Activity
Gram+ & Gram-, Virus, HIV,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.