Home > Product > Antimicrobial Peptides > ETD130

Antimicrobial Peptides

CAT#
AF3067
Sequence
DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCER
Host Chemicals
Synthetic construct
Length
44
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.