Home > Product > Catalog Peptides > Others > Exendin-3

Others

warning All products are for research use only. Not for human use.
CAT#
E10003
Sequence
SDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
4202.7
Molecular Formula
C184H282N50O61S1
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.