Home > Product > Antimicrobial Peptides > FeCath

Antimicrobial Peptides

CAT#
AF2666
Sequence
QLGELIQQGGQKIVEKIQKIGQRIRDFFSNLRPRQEA
Host Chemicals
Felis catus
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.