Home > Product > Catalog Peptides > Others > Fibronectin type-II 3

Others

Fibronectin type-II 3

[Price Inquiry]
CAT#
M13011
Sequence
SEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPD
Modifications
Disulfide bond(2)
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.