CAT# | G01017 |
M.F/Formula | C146H213N43O40 |
M.W/Mr. | 3210.6 |
Sequence | GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 |
Length | 29 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
CAD-082 | (Asp(4-aminobutylamide)¹·⁷·²³,Glu(4-aminobutylamide)³·¹¹·²²)-Amyloid β-Protein (1-40) | Inquiry | ||
CAD-105 | TRAF6 (cell permeable) | Inquiry | ||
CAD-097 | 1-O-Hexadecyl-2-O-acetyl-sn-glycero-3-phosphocholine | Inquiry | ||
Q0806 | MeOSuc-Glu-Val-Lys-Met-pNA | Inquiry | ||
Q0807 | H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...