Various Products/Alzheimer's Disease

Galanin, porcine

Price Inquiry
CAT#
G01017
Sequence
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
M.W/Mr.
3210.6
Molecular Formula
C146H213N43O40
Length
29

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.