Various Products/Alzheimer's Disease

warning All products are for research use only. Not for human use.

Galanin, porcine

[Price Inquiry]
CAT#
G01017
Sequence
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
M.W/Mr.
3210.6
Molecular Formula
C146H213N43O40
Length
29
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.