Home > Product > Catalog Peptides > Others > Gastrin Releasing Peptide, porcine

Others

Gastrin Releasing Peptide, porcine

[Price Inquiry]
CAT#
G03015
Sequence
APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
M.W/Mr.
2805.4
Molecular Formula
C126H198N38O31S2
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.