Keywords Search Google Search Search

Ginkbilobin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2803
Sequence	ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG
Activity	Antibacterial, Antifungal, Antiviral

CAT#	Product Name	Inquiry
AF602	Myeloid antimicrobial peptide BMAP-27	Inquiry
AF834	Bicarinalin	Inquiry
AF1514	Midgut defensin	Inquiry
AF135	Grammistin Gs B	Inquiry
AF2543	Ceratotoxin-D	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

Clinical efficacy of antazoline in rapid cardioversion of paroxysmal atrial fibrillation

Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...

Function of Norleual in Pancreatic Cancer

Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...

Inhibition of mast cell tryptase by APC 366

APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...

Abaloparatide Helps Osteoporotic Fractures Treatment

What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Ginkgo biloba
Length	40
SwissProt ID	P83171