Home > Product > Antimicrobial Peptides > Ginkbilobin

Antimicrobial Peptides

Ginkbilobin

[Price Inquiry]
CAT#
AF2803
Sequence
ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG
Host Chemicals
Ginkgo biloba
Length
40
Activity
Antibacterial, Antifungal, Antiviral
SwissProt ID
P83171
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.