Keywords Search Google Search Search

[Gln22]-beta-Amyloid (6-40)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13227
M.W/Mr.	3710.2
Sequence	HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13198	Beta-Amyloid (11-40), mouse, rat	Inquiry
A13110	Beta-Amyloid (1-16), mouse, rat	Inquiry
A13114	Beta-Amyloid (3-17)	Inquiry
A13049	Beta-Amyloid (22-35)	Inquiry
A13283	[Arg22] b-Amyloid (1-40)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

Glucagon-like peptide-1 (7-36) amide

The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...

Comprehensive effect of angiotensin II acetate

Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: