Home > Product > Catalog Peptides > β-Amyloid Mutations > [Gln9]-beta-Amyloid (1-40)

β-Amyloid Mutations

warning All products are for research use only. Not for human use.

[Gln9]-beta-Amyloid (1-40)

[Price Inquiry]
CAT#
A13287
Sequence
DAEFRHDSQYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
M.W/Mr.
4401
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.