Keywords Search Google Search Search

GLP-2 (rat)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R0838
CAS	195262-56-7
M.F/Formula	C166H256N44O56S
M.W/Mr.	3796.17
Sequence	HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Application	Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

CAT#	Product Name	Inquiry
X01726	PH1PO087_20	Inquiry
X03702	PM_11020275	Inquiry
X19532	UP_P80901	Inquiry
X01496	PH1PO031_03	Inquiry
X20209	UP_P84558	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

A novel antiarrhythmic peptide–rotigaptide

Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...

Function of spadin in neurological treatment of depression

Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

Function of PMX-53 as an antagonists

PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...

The efficacy of teicoplanin in the treatment of Gram-positive cocci infection

Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: