Home > Product > Catalog Peptides > Others > GRF (1-29) amide (human)

Others

GRF (1-29) amide (human)

Price Inquiry
CAT#
G09002
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
M.W/Mr.
3357.93
Molecular Formula
C149H246N44O42S
Length
29

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.