Home > Product > Catalog Peptides > Others > GRF (1-29) amide (human)

Others

GRF (1-29) amide (human)

[Price Inquiry]
CAT#
G09002
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
M.W/Mr.
3357.93
Molecular Formula
C149H246N44O42S
Length
29
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.