Keywords Search Google Search Search

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1403
M.W/Mr.	3850.31
Sequence	One Letter Code: GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS three Letter Code: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

CAT#	Product Name	Inquiry
R1147	Acetyl-PHF6 amide TFA	Inquiry
R1460	JAG-1, scrambled	Inquiry
R1893	Difelikefalin	Inquiry
R1764	α-Neoendorphin 1-8	Inquiry
R1834	Furin Inhibitor II	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Broad-spectrum antibacterial activity of PR 39

PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...

What is peptide YY?

The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...

Function of myristoyl pentapeptide-7 in skin and eyelash

Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...

UT receptor peptide antagonist-UFP 803

UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...

The Function of CRF (ovine) Trifluoroacetate in Parkinson's Disease

Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: