Home > Product > Catalog Peptides > Others > Hemolytic toxin

Others

Hemolytic toxin

[Price Inquiry]
CAT#
H17001
Sequence
SAALAGTIIAGASLGFQILDKVLGELGKVSRKIAIGVDNESIGSNTAWTXXXXW
Length
54
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.